Lineage for d1enxa_ (1enx A:)
- Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) 
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) Protein Xylanase II [49979] (16 species)
Partial overlap with common fold and the active sites of the other endoglucanasesSpecies Trichoderma reesei, xynII [TaxId:51453] [49985] (10 PDB entries) 
Domain d1enxa_: 1enx A: [24325]
Details for d1enxa_
PDB Entry: 1enx (more details), 1.5 Å
PDB Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei
PDB Compounds: (A:) endo-1,4-beta-xylanase IISCOP Domain Sequences for d1enxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1enxa_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs
SCOP Domain Coordinates for d1enxa_:
Click to download the PDB-style file with coordinates for d1enxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1enxa_:
- d1enxa_ first appeared (with stable ids) in SCOP 1.55
- d1enxa_ appears in SCOP 1.71
- d1enxa_ appears in SCOP 1.75
- d1enxa_ appears in the current release, SCOPe 2.08, called d1enxa1
View in 3D
