Lineage for d1enxa_ (1enx A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12850Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins)
  6. 12855Protein Xylanase II [49979] (11 species)
  7. 12890Species Trichoderma reesei, xynII [TaxId:51453] [49985] (6 PDB entries)
  8. 12891Domain d1enxa_: 1enx A: [24325]

Details for d1enxa_

PDB Entry: 1enx (more details), 1.5 Å

PDB Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei

SCOP Domain Sequences for d1enxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enxa_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOP Domain Coordinates for d1enxa_:

Click to download the PDB-style file with coordinates for d1enxa_.
(The format of our PDB-style files is described here.)

Timeline for d1enxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1enxb_