SCOP 1.71: Domain d1enxa_: 1enx A:

Lineage for d1enxa_ (1enx A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (16 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei, xynII [TaxId:51453] [49985] (6 PDB entries)

8. Domain d1enxa_: 1enx A: [24325]

Details for d1enxa_

PDB Entry: 1enx, 1.5 Å

PDB Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei

SCOP Domain Sequences for d1enxa_:

Sequence; same for both SEQRES and ATOM records:

>d1enxa_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

Timeline for d1enxa_:

• d1enxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1enxa_ appears in SCOP 1.69
  
• d1enxa_ appears in SCOP 1.73
  
• d1enxa_ appears in the current release, SCOPe 2.08, called d1enxa1