Lineage for d2df0a1 (2df0 A:1-34)

  1. Root: SCOPe 2.04
  2. 1713148Class j: Peptides [58231] (126 folds)
  3. 1713367Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 1713368Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 1713369Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 1713449Protein Peptide YY, PYY [58292] (2 species)
  7. 1713450Species Human (Homo sapiens) [TaxId:9606] [144317] (2 PDB entries)
    Uniprot P10082 29-64! Uniprot P10082 31-64
  8. 1713452Domain d2df0a1: 2df0 A:1-34 [131443]

Details for d2df0a1

PDB Entry: 2df0 (more details)

PDB Description: solution structure of human pyy3-36
PDB Compounds: (A:) Peptide YY

SCOPe Domain Sequences for d2df0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2df0a1 j.6.1.1 (A:1-34) Peptide YY, PYY {Human (Homo sapiens) [TaxId: 9606]}
ikpeapgedaspeelnryyaslrhylnlvtrqry

SCOPe Domain Coordinates for d2df0a1:

Click to download the PDB-style file with coordinates for d2df0a1.
(The format of our PDB-style files is described here.)

Timeline for d2df0a1: