PDB entry 2df0

View 2df0 on RCSB PDB site
Description: Solution structure of human PYY3-36
Class: neuropeptide
Keywords: PP-fold, PYY, peptide, helix, amphipathic, neuropeptide
Deposited on 2006-02-20, released 2006-07-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide YY
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2df0a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2df0A (A:)
    ikpeapgedaspeelnryyaslrhylnlvtrqry