| Class b: All beta proteins [48724] (174 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein Xylanase II [49979] (17 species) Partial overlap with common fold and the active sites of the other endoglucanases |
| Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries) |
| Domain d2dcye_: 2dcy E: [131392] automated match to d2dcya1 complexed with dio, tar |
PDB Entry: 2dcy (more details), 1.4 Å
SCOPe Domain Sequences for d2dcye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dcye_ b.29.1.11 (E:) Xylanase II {Bacillus subtilis [TaxId: 1423]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw
Timeline for d2dcye_:
View in 3DDomains from other chains: (mouse over for more information) d2dcya_, d2dcyb_, d2dcyc_, d2dcyd_ |