Lineage for d2dcya1 (2dcy A:1-185)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 944939Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 944984Protein Xylanase II [49979] (17 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 945019Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries)
  8. 945020Domain d2dcya1: 2dcy A:1-185 [131388]
    automatically matched to d1axka2
    complexed with dio, tar

Details for d2dcya1

PDB Entry: 2dcy (more details), 1.4 Å

PDB Description: crystal structure of bacillus subtilis family-11 xylanase
PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2dcya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dcya1 b.29.1.11 (A:1-185) Xylanase II {Bacillus subtilis [TaxId: 1423]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOPe Domain Coordinates for d2dcya1:

Click to download the PDB-style file with coordinates for d2dcya1.
(The format of our PDB-style files is described here.)

Timeline for d2dcya1: