![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein automated matches [190264] (12 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187053] (8 PDB entries) |
![]() | Domain d2dcaa_: 2dca A: [131369] automated match to d1itoa_ complexed with 75v, gol, po4 |
PDB Entry: 2dca (more details), 2.11 Å
SCOPe Domain Sequences for d2dcaa_:
Sequence, based on SEQRES records: (download)
>d2dcaa_ d.3.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} lpesfdareqwpncptikeirdqgscgscwafgaveaisdricihsngrvnvevsaedml tccggecgdgcnggfpsgawnfwtkkglvsgglynshvgcrpysippcehhvngsrppct gegdtpkcsktcepgyspsykedkhfgcssysvannekeimaeiykngpvegafsvysdf llyksgvyqhvsgeimgghairilgwgvengtpywlvgnswntdwgdngffkilrgqdhc gieseivagmpct
>d2dcaa_ d.3.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} lpesfdareqwpncptikeirdqgscgscwafgaveaisdricihsnvnvevsaedmltc cggecgdgcnggfpsgawnfwtkkglvsgglynshvgcrpysippcehhvngsrppctge gdtpkcsktcepgyspsykedkhfgcssysvannekeimaeiykngpvegafsvysdfll yksgvyqhvsgeimgghairilgwgvengtpywlvgnswntdwgdngffkilrgqdhcgi eseivagmpct
Timeline for d2dcaa_: