SCOPe 2.07: Domain d2d98a_: 2d98 A:

Lineage for d2d98a_ (2d98 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei, xynII [TaxId:51453] [49985] (16 PDB entries)

8. Domain d2d98a_: 2d98 A: [131345]
   automated match to d1enxa_
   complexed with iod

Details for d2d98a_

PDB Entry: 2d98, 2 Å

PDB Description: Structure of VIL (extra KI/I2 added)-xylanase

PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d2d98a_:

Sequence; same for both SEQRES and ATOM records:

>d2d98a_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

Timeline for d2d98a_:

• d2d98a_ first appeared in SCOP 1.73, called d2d98a1
  
• d2d98a_ appears in SCOPe 2.06
  
• d2d98a_ appears in the current release, SCOPe 2.08