Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Trichoderma reesei, xynII [TaxId:51453] [49985] (16 PDB entries) |
Domain d2d98a_: 2d98 A: [131345] automated match to d1enxa_ complexed with iod |
PDB Entry: 2d98 (more details), 2 Å
SCOPe Domain Sequences for d2d98a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d98a_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]} tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs sgsasitvs
Timeline for d2d98a_: