SCOP 1.73: Domain d2d8xa1: 2d8x A:33-64

Lineage for d2d8xa1 (2d8x A:33-64)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Pinch (particularly interesting new Cys-His) protein [57741] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57742] (5 PDB entries)

8. Domain d2d8xa1: 2d8x A:33-64 [131337]
   2nd LIM domain
   complexed with zn

Details for d2d8xa1

PDB Entry: 2d8x

PDB Description: solution structure of the second lim domain of particularly interesting new cys-his protein (pinch)

PDB Compounds: (A:) Protein PINCH

SCOP Domain Sequences for d2d8xa1:

Sequence; same for both SEQRES and ATOM records:

>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]}
rcdlcqevladigfvknagrhlcrpchnreka

Timeline for d2d8xa1:

• d2d8xa1 is new in SCOP 1.73
  
• d2d8xa1 appears in SCOP 1.75
  
• d2d8xa1 appears in the current release, SCOPe 2.08