Class g: Small proteins [56992] (90 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) |
Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
Protein Pinch (particularly interesting new Cys-His) protein [57741] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57742] (5 PDB entries) |
Domain d2d8xa1: 2d8x A:33-64 [131337] 2nd LIM domain complexed with zn |
PDB Entry: 2d8x (more details)
SCOP Domain Sequences for d2d8xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} rcdlcqevladigfvknagrhlcrpchnreka
Timeline for d2d8xa1: