Lineage for d2d8xa1 (2d8x A:33-64)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035841Protein Pinch (particularly interesting new Cys-His) protein [57741] (1 species)
  7. 3035842Species Human (Homo sapiens) [TaxId:9606] [57742] (5 PDB entries)
  8. 3035843Domain d2d8xa1: 2d8x A:33-64 [131337]
    Other proteins in same PDB: d2d8xa3, d2d8xa4
    2nd LIM domain
    complexed with zn

Details for d2d8xa1

PDB Entry: 2d8x (more details)

PDB Description: solution structure of the second lim domain of particularly interesting new cys-his protein (pinch)
PDB Compounds: (A:) Protein PINCH

SCOPe Domain Sequences for d2d8xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]}
rcdlcqevladigfvknagrhlcrpchnreka

SCOPe Domain Coordinates for d2d8xa1:

Click to download the PDB-style file with coordinates for d2d8xa1.
(The format of our PDB-style files is described here.)

Timeline for d2d8xa1: