SCOPe 2.03: Domain d2d7ma1: 2d7m A:8-109

Lineage for d2d7ma1 (2d7m A:8-109)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein Filamin C [117049] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117050] (7 PDB entries)
   Uniprot Q14315 2633-2725

8. Domain d2d7ma1: 2d7m A:8-109 [131321]
   14th repeat

Details for d2d7ma1

PDB Entry: 2d7m

PDB Description: solution structure of the 14th filamin domain from human filamin c

PDB Compounds: (A:) Filamin-C

SCOPe Domain Sequences for d2d7ma1:

Sequence; same for both SEQRES and ATOM records:

>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]}
ahdaskvrasgpglnasgipaslpveftidardageglltvqildpegkpkkanirdngd
gtytvsylpdmsgrytitikyggdeipyspfrihalptgdas

Timeline for d2d7ma1:

• d2d7ma1 first appeared in SCOP 1.73
  
• d2d7ma1 appears in SCOPe 2.02
  
• d2d7ma1 appears in SCOPe 2.04
  
• d2d7ma1 appears in the current release, SCOPe 2.08