SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2d7ma1 (2d7m A:8-109)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2032738Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 protein domains)
    Pfam PF00630
  6. 2032782Protein Filamin C [117049] (1 species)
  7. 2032783Species Human (Homo sapiens) [TaxId:9606] [117050] (6 PDB entries)
    Uniprot Q14315 2633-2725
  8. 2032786Domain d2d7ma1: 2d7m A:8-109 [131321]
    Other proteins in same PDB: d2d7ma2, d2d7ma3
    14th repeat

Details for d2d7ma1

PDB Entry: 2d7m (more details)

PDB Description: Solution structure of the 14th Filamin domain from human Filamin C
PDB Compounds: (A:) Filamin-C

SCOPe Domain Sequences for d2d7ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]}
ahdaskvrasgpglnasgipaslpveftidardageglltvqildpegkpkkanirdngd
gtytvsylpdmsgrytitikyggdeipyspfrihalptgdas

SCOPe Domain Coordinates for d2d7ma1:

Click to download the PDB-style file with coordinates for d2d7ma1.
(The format of our PDB-style files is described here.)

Timeline for d2d7ma1: