Lineage for d2d7ma1 (2d7m A:8-109)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 659093Family b.1.18.10: Filamin repeat (rod domain) [81290] (4 proteins)
    Pfam PF00630
  6. 659125Protein Filamin C [117049] (1 species)
  7. 659126Species Human (Homo sapiens) [TaxId:9606] [117050] (6 PDB entries)
  8. 659128Domain d2d7ma1: 2d7m A:8-109 [131321]
    14th repeat

Details for d2d7ma1

PDB Entry: 2d7m (more details)

PDB Description: solution structure of the 14th filamin domain from human filamin c
PDB Compounds: (A:) Filamin-C

SCOP Domain Sequences for d2d7ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]}
ahdaskvrasgpglnasgipaslpveftidardageglltvqildpegkpkkanirdngd
gtytvsylpdmsgrytitikyggdeipyspfrihalptgdas

SCOP Domain Coordinates for d2d7ma1:

Click to download the PDB-style file with coordinates for d2d7ma1.
(The format of our PDB-style files is described here.)

Timeline for d2d7ma1: