SCOPe 2.08: Domain d2d5ua1: 2d5u A:6-124

Lineage for d2d5ua1 (2d5u A:6-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.314: PUG domain-like [143502] (1 superfamily)
   alpha(2)-beta-alpha(2)-beta(2)-alpha; cluster of helices with a small antiparallel beta-sheet on one side; order 132; topological similarity to the fold of an extended R3H domain (PDB 1whr)

4. Superfamily d.314.1: PUG domain-like [143503] (1 family)

5. Family d.314.1.1: PUG domain [143504] (2 proteins)
   SMART 00580; domain in protein kinases, N-glycanases and other nuclear proteins

6. Protein N-glycanase 1, N-terminal domain [143505] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [143506] (1 PDB entry)
   Uniprot Q9JI78 1-119

8. Domain d2d5ua1: 2d5u A:6-124 [131281]
   Other proteins in same PDB: d2d5ua2

Details for d2d5ua1

PDB Entry: 2d5u

PDB Description: solution structure of the n-terminal portion of the pub domain of mouse peptide:n-glycanase

PDB Compounds: (A:) N-glycanase 1

SCOPe Domain Sequences for d2d5ua1:

Sequence; same for both SEQRES and ATOM records:

>d2d5ua1 d.314.1.1 (A:6-124) N-glycanase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
masatlgsssssaspavaelcqntpetfleaskllltyadnilrnpsdekyrsirignta
fstrllpvrgaveclfemgfeegethlifpkkasveqlqkirdliaierssrldgsskk

Timeline for d2d5ua1:

• d2d5ua1 first appeared in SCOP 1.73
  
• d2d5ua1 appears in SCOPe 2.07