PDB entry 2d5u

View 2d5u on RCSB PDB site
Description: Solution structure of the N-terminal portion of the PUB domain of mouse peptide:N-glycanase
Class: hydrolase
Keywords: PNGase, HYDROLASE
Deposited on 2005-11-06, released 2006-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: N-glycanase 1
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • GB NP_067479 (5-123)
    • cloning artifact (0-4)
  Domains in SCOPe 2.08: d2d5ua1, d2d5ua2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d5uA (A:)
  gplgsmasatlgsssssaspavaelcqntpetfleaskllltyadnilrnpsdekyrsir
  igntafstrllpvrgaveclfemgfeegethlifpkkasveqlqkirdliaierssrldg
  sskk