![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.314: PUG domain-like [143502] (1 superfamily) alpha(2)-beta-alpha(2)-beta(2)-alpha; cluster of helices with a small antiparallel beta-sheet on one side; order 132; topological similarity to the fold of an extended R3H domain (PDB 1whr) |
![]() | Superfamily d.314.1: PUG domain-like [143503] (1 family) ![]() |
![]() | Family d.314.1.1: PUG domain [143504] (1 protein) SMART 00580; domain in protein kinases, N-glycanases and other nuclear proteins |
![]() | Protein N-glycanase 1, N-terminal domain [143505] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [143506] (1 PDB entry) |
![]() | Domain d2d5ua1: 2d5u A:6-124 [131281] |
PDB Entry: 2d5u (more details)
SCOP Domain Sequences for d2d5ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d5ua1 d.314.1.1 (A:6-124) N-glycanase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} masatlgsssssaspavaelcqntpetfleaskllltyadnilrnpsdekyrsirignta fstrllpvrgaveclfemgfeegethlifpkkasveqlqkirdliaierssrldgsskk
Timeline for d2d5ua1: