SCOPe 2.06: Domain d2d4ca1: 2d4c A:11-247

Lineage for d2d4ca1 (2d4c A:11-247)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.1: BAR domain [103658] (4 proteins)
   sensor of membrane curvature

6. Protein Endophilin-1 [140699] (3 species)
   SH3-containing GRB2-like protein 2

7. Species Human (Homo sapiens) [TaxId:9606] [140701] (3 PDB entries)
   Uniprot Q99962 11-247! Uniprot Q99962 26-247

8. Domain d2d4ca1: 2d4c A:11-247 [131246]
   Other proteins in same PDB: d2d4cb_, d2d4cc_, d2d4cd_
   complexed with ca; mutant

Details for d2d4ca1

PDB Entry: 2d4c, 2.4 Å

PDB Description: Crystal structure of the endophilin BAR domain mutant

PDB Compounds: (A:) sh3-containing grb2-like protein 2

SCOPe Domain Sequences for d2d4ca1:

Sequence, based on SEQRES records:

>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]}
hkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsm
intmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkds
ldievkqnfidplqnlhdkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqa
lekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleer

Sequence, based on observed residues (ATOM records):

>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]}
hkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklyp
qaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfidplqnlh
dkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqalekfdeskeiaessmfn
llemdieqvsqlsalvqaqleyhkqavqilqqvtvrleer

Timeline for d2d4ca1:

• d2d4ca1 first appeared in SCOP 1.73
  
• d2d4ca1 appears in SCOPe 2.05
  
• d2d4ca1 appears in SCOPe 2.07
  
• d2d4ca1 appears in the current release, SCOPe 2.08