SCOPe 2.08: Domain d2d30b_: 2d30 B:

Lineage for d2d30b_ (2d30 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
   strand 5 is antiparallel to strand 4

6. Protein mono-domain cytidine deaminase [75327] (6 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [142829] (1 PDB entry)
   Uniprot Q81LT6 1-124

8. Domain d2d30b_: 2d30 B: [131191]
   automated match to d1jtka_
   complexed with zn

Details for d2d30b_

PDB Entry: 2d30, 2.4 Å

PDB Description: Crystal Structure of Cytidine Deaminase Cdd-2 (BA4525) from Bacillus Anthracis at 2.40A Resolution

PDB Compounds: (B:) Cytidine deaminase

SCOPe Domain Sequences for d2d30b_:

Sequence; same for both SEQRES and ATOM records:

>d2d30b_ c.97.1.1 (B:) mono-domain cytidine deaminase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mnskqliqeaiearkqayvpyskfqvgaalltqdgkvyrgcnvenasyglcncaertalf
kavsegdkefvaiaivadtkrpvppcgacrqvmvelckqdtkvylsnlhgdvqettvgel
lpga

Timeline for d2d30b_:

• d2d30b_ first appeared in SCOP 1.73, called d2d30b1
  
• d2d30b_ appears in SCOPe 2.07