Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.1: Cytidine deaminase [53928] (4 proteins) strand 5 is antiparallel to strand 4 |
Protein mono-domain cytidine deaminase [75327] (6 species) |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [142829] (1 PDB entry) Uniprot Q81LT6 1-124 |
Domain d2d30b_: 2d30 B: [131191] automated match to d1jtka_ complexed with zn |
PDB Entry: 2d30 (more details), 2.4 Å
SCOPe Domain Sequences for d2d30b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d30b_ c.97.1.1 (B:) mono-domain cytidine deaminase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mnskqliqeaiearkqayvpyskfqvgaalltqdgkvyrgcnvenasyglcncaertalf kavsegdkefvaiaivadtkrpvppcgacrqvmvelckqdtkvylsnlhgdvqettvgel lpga
Timeline for d2d30b_: