Lineage for d2d30a1 (2d30 A:1-124)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918483Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
    strand 5 is antiparallel to strand 4
  6. 2918487Protein mono-domain cytidine deaminase [75327] (6 species)
  7. 2918488Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [142829] (1 PDB entry)
    Uniprot Q81LT6 1-124
  8. 2918489Domain d2d30a1: 2d30 A:1-124 [131190]
    complexed with zn

Details for d2d30a1

PDB Entry: 2d30 (more details), 2.4 Å

PDB Description: Crystal Structure of Cytidine Deaminase Cdd-2 (BA4525) from Bacillus Anthracis at 2.40A Resolution
PDB Compounds: (A:) Cytidine deaminase

SCOPe Domain Sequences for d2d30a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d30a1 c.97.1.1 (A:1-124) mono-domain cytidine deaminase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mnskqliqeaiearkqayvpyskfqvgaalltqdgkvyrgcnvenasyglcncaertalf
kavsegdkefvaiaivadtkrpvppcgacrqvmvelckqdtkvylsnlhgdvqettvgel
lpga

SCOPe Domain Coordinates for d2d30a1:

Click to download the PDB-style file with coordinates for d2d30a1.
(The format of our PDB-style files is described here.)

Timeline for d2d30a1: