SCOP 1.73: Domain d2d30b1: 2d30 B:1-124

Lineage for d2d30b1 (2d30 B:1-124)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.1: Cytidine deaminase [53928] (3 proteins)
   strand 5 is antiparallel to strand 4

6. Protein mono-domain cytidine deaminase [75327] (5 species)

7. Species Bacillus anthracis [TaxId:1392] [142829] (1 PDB entry)

8. Domain d2d30b1: 2d30 B:1-124 [131191]
   automatically matched to 2D30 A:1-124
   complexed with zn

Details for d2d30b1

PDB Entry: 2d30, 2.4 Å

PDB Description: Crystal Structure of Cytidine Deaminase Cdd-2 (BA4525) from Bacillus Anthracis at 2.40A Resolution

PDB Compounds: (B:) Cytidine deaminase

SCOP Domain Sequences for d2d30b1:

Sequence; same for both SEQRES and ATOM records:

>d2d30b1 c.97.1.1 (B:1-124) mono-domain cytidine deaminase {Bacillus anthracis [TaxId: 1392]}
mnskqliqeaiearkqayvpyskfqvgaalltqdgkvyrgcnvenasyglcncaertalf
kavsegdkefvaiaivadtkrpvppcgacrqvmvelckqdtkvylsnlhgdvqettvgel
lpga

Timeline for d2d30b1:

• d2d30b1 is new in SCOP 1.73
  
• d2d30b1 appears in SCOP 1.75
  
• d2d30b1 appears in the current release, SCOPe 2.08, called d2d30b_