Lineage for d2d29a1 (2d29 A:235-387)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708345Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 2708352Protein Acyl-CoA dehydrogenase [140473] (1 species)
  7. 2708353Species Thermus thermophilus [TaxId:274] [140474] (3 PDB entries)
    Uniprot Q5SGZ2 235-387
  8. 2708354Domain d2d29a1: 2d29 A:235-387 [131157]
    Other proteins in same PDB: d2d29a2, d2d29b2
    automated match to d1ws9a1
    complexed with fad

Details for d2d29a1

PDB Entry: 2d29 (more details), 1.65 Å

PDB Description: Structural study on project ID TT0172 from Thermus thermophilus HB8
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2d29a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}
gkgfydvlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaea
ateleaarllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdyp
verywrdarltrigegtseilklviarrlleav

SCOPe Domain Coordinates for d2d29a1:

Click to download the PDB-style file with coordinates for d2d29a1.
(The format of our PDB-style files is described here.)

Timeline for d2d29a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d29a2