![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
![]() | Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
![]() | Family d.151.1.1: DNase I-like [56220] (7 proteins) |
![]() | Protein Deoxyribonuclease I [56225] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56226] (11 PDB entries) |
![]() | Domain d2d1kb_: 2d1k B: [131131] Other proteins in same PDB: d2d1ka1, d2d1ka2 automated match to d1dnka_ protein/DNA complex; complexed with atp, ca, mg |
PDB Entry: 2d1k (more details), 2.5 Å
SCOPe Domain Sequences for d2d1kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d1kb_ d.151.1.1 (B:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg lsnemalaisdhypvevtlt
Timeline for d2d1kb_: