Lineage for d2d1kb_ (2d1k B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437447Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1437448Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1437449Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 1437458Protein Deoxyribonuclease I [56225] (1 species)
  7. 1437459Species Cow (Bos taurus) [TaxId:9913] [56226] (11 PDB entries)
  8. 1437469Domain d2d1kb_: 2d1k B: [131131]
    Other proteins in same PDB: d2d1ka1, d2d1ka2
    automated match to d1dnka_
    protein/DNA complex; complexed with atp, ca, mg

Details for d2d1kb_

PDB Entry: 2d1k (more details), 2.5 Å

PDB Description: ternary complex of the wh2 domain of mim with actin-dnase i
PDB Compounds: (B:) Deoxyribonuclease-1

SCOPe Domain Sequences for d2d1kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1kb_ d.151.1.1 (B:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

SCOPe Domain Coordinates for d2d1kb_:

Click to download the PDB-style file with coordinates for d2d1kb_.
(The format of our PDB-style files is described here.)

Timeline for d2d1kb_: