SCOPe 2.08: Domain d2d0ha3: 2d0h A:123-554

Lineage for d2d0ha3 (2d0h A:123-554)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Maltogenic amylase, central domain [51465] (4 species)
   contains an additional N-terminal domain

7. Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75061] (8 PDB entries)

8. Domain d2d0ha3: 2d0h A:123-554 [131072]
   Other proteins in same PDB: d2d0ha1, d2d0ha2
   automated match to d1uh4a3
   complexed with ca, mpd; mutant
   has additional subdomain(s) that are not in the common domain

Details for d2d0ha3

PDB Entry: 2d0h, 2.1 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 1 (tvai) mutant d356n/e396q complexed with p2, a pullulan model oligosaccharide

PDB Compounds: (A:) alpha-amylase I

SCOPe Domain Sequences for d2d0ha3:

Sequence; same for both SEQRES and ATOM records:

>d2d0ha3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
nfktpdwlkngvmyqifpdrfyngdssndvqtgsytyngtptekkawgssvyadpgydns
lvffggdlagidqklgyikktlganilylnpifkaptnhkydtqdymavdpafgdnstlq
tlindihstangpkgylildgvfnhtgdshpwfdkynnfssqgayesqsspwynyytfyt
wpdsyasflgfnslpklnygnsgsavrgviynnsnsvaktylnppysvdgwrlnaaqyvd
angnngsdvtnhqiwsefrnavkgvnsnaaiigqywgnanpwtaqgnqwdaatnfdgftq
pvsewitgkdyqnnsasisttqfdswlrgtranyptnvqqsmmnflsnhditrfatrsgg
dlwktylalifqmtyvgtptiyygdeygmqggadpdnrrsfdwsqatpsnsavaltqkli
tirnqypalrtg

Timeline for d2d0ha3:

• d2d0ha3 first appeared in SCOP 1.73
  
• d2d0ha3 appears in SCOPe 2.07