SCOPe 2.01: Domain d2czla1: 2czl A:3-272

Lineage for d2czla1 (2czl A:3-272)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Hypothetical protein TTHA1568 [142806] (1 species)
   member of Pfam PF02642 (DUF191)

7. Species Thermus thermophilus [TaxId:274] [142807] (2 PDB entries)
   Uniprot Q5SI12 3-272

8. Domain d2czla1: 2czl A:3-272 [131055]
   complexed with k, tla, xpe

Details for d2czla1

PDB Entry: 2czl, 1.55 Å

PDB Description: Crystal structure of MqnD (TTHA1568), a menaquinone biosynthetic enzyme from Thermus thermophilus HB8 (Cys11 modified with beta-mercaptoethanol)

PDB Compounds: (A:) hypothetical protein TTHA1568

SCOPe Domain Sequences for d2czla1:

Sequence; same for both SEQRES and ATOM records:

>d2czla1 c.94.1.1 (A:3-272) Hypothetical protein TTHA1568 {Thermus thermophilus [TaxId: 274]}
alrlgfspcpndtfifyalvhgrvespvplepvledvetlnrwalegrlpltklsyaaya
qvrdryvalrsggalgrgvgplvvargplqaleglrvavpgrhttayfllslyaqgfvpv
evrydrilpmvaqgeveagliihesrftypryglvqvvdlgawweertglplplgailar
rdlgegliraldeavrrsvayalahpeealdymrahaqelsdeviwahvhtyvnafsldv
geegeravarlfaeaearglaapsprplfv

Timeline for d2czla1:

• d2czla1 first appeared in SCOP 1.73
  
• d2czla1 appears in SCOP 1.75
  
• d2czla1 appears in SCOPe 2.02
  
• d2czla1 appears in the current release, SCOPe 2.08