Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins) |
Protein Hypothetical protein TTHA1568 [142806] (1 species) member of Pfam PF02642 (DUF191) |
Species Thermus thermophilus [TaxId:274] [142807] (2 PDB entries) Uniprot Q5SI12 3-272 |
Domain d2czla1: 2czl A:3-272 [131055] complexed with k, tla, xpe |
PDB Entry: 2czl (more details), 1.55 Å
SCOP Domain Sequences for d2czla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2czla1 c.94.1.1 (A:3-272) Hypothetical protein TTHA1568 {Thermus thermophilus [TaxId: 274]} alrlgfspcpndtfifyalvhgrvespvplepvledvetlnrwalegrlpltklsyaaya qvrdryvalrsggalgrgvgplvvargplqaleglrvavpgrhttayfllslyaqgfvpv evrydrilpmvaqgeveagliihesrftypryglvqvvdlgawweertglplplgailar rdlgegliraldeavrrsvayalahpeealdymrahaqelsdeviwahvhtyvnafsldv geegeravarlfaeaearglaapsprplfv
Timeline for d2czla1: