Lineage for d2czje1 (2czj E:2-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821154Fold b.111: Small protein B (SmpB) [74981] (2 superfamilies)
    barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold
  4. 2821155Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) (S)
  5. 2821156Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)
  6. 2821157Protein Small protein B (SmpB) [74984] (2 species)
    tmRNA-binding protein; SsrA-binding protein
  7. 2821162Species Thermus thermophilus [TaxId:274] [82130] (5 PDB entries)
    Uniprot Q8RR57 4-123
  8. 2821166Domain d2czje1: 2czj E:2-123 [131053]
    automatically matched to d1j1ha_
    protein/RNA complex

Details for d2czje1

PDB Entry: 2czj (more details), 3.01 Å

PDB Description: Crystal structure of the tRNA domain of tmRNA from Thermus thermophilus HB8
PDB Compounds: (E:) SsrA-binding protein

SCOPe Domain Sequences for d2czje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2czje1 b.111.1.1 (E:2-123) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]}
apvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyia
pyekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglar
gk

SCOPe Domain Coordinates for d2czje1:

Click to download the PDB-style file with coordinates for d2czje1.
(The format of our PDB-style files is described here.)

Timeline for d2czje1: