PDB entry 2czj

View 2czj on RCSB PDB site
Description: Crystal structure of the tRNA domain of tmRNA from Thermus thermophilus HB8
Class: RNA binding protein/RNA
Keywords: SmpB, tmRNA, SsrA RNA, 10Sa RNA, tRNA, trans-translation, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN-RNA COMPLEX
Deposited on 2005-07-13, released 2006-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.255
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SsrA-binding protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2czja1
  • Chain 'B':
    Compound: tmRNA (63-MER)
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: SsrA-binding protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2czjc1
  • Chain 'D':
    Compound: tmRNA (63-MER)
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: SsrA-binding protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2czje1
  • Chain 'F':
    Compound: tmRNA (63-MER)
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: SsrA-binding protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2czjg1
  • Chain 'H':
    Compound: tmRNA (63-MER)
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2czjA (A:)
    mapvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyi
    apyekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllgla
    rgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czjA (A:)
    apvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyia
    pyekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglar
    gk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2czjC (C:)
    mapvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyi
    apyekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllgla
    rgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czjC (C:)
    apvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyia
    pyyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2czjE (E:)
    mapvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyi
    apyekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllgla
    rgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czjE (E:)
    apvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyia
    pyekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglar
    gk
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2czjG (G:)
    mapvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyi
    apyekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllgla
    rgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czjG (G:)
    vlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiapy
    ekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargk
    

  • Chain 'H':
    No sequence available.