Lineage for d2czje1 (2czj E:2-123)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679428Fold b.111: Small protein B (SmpB) [74981] (1 superfamily)
    barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold
  4. 679429Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) (S)
  5. 679430Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)
  6. 679431Protein Small protein B (SmpB) [74984] (2 species)
    tmRNA-binding protein; SsrA-binding protein
  7. 679439Species Thermus thermophilus [TaxId:274] [82130] (3 PDB entries)
  8. 679443Domain d2czje1: 2czj E:2-123 [131053]
    automatically matched to d1j1ha_
    complexed with 5mu, psu

Details for d2czje1

PDB Entry: 2czj (more details), 3.01 Å

PDB Description: Crystal structure of the tRNA domain of tmRNA from Thermus thermophilus HB8
PDB Compounds: (E:) SsrA-binding protein

SCOP Domain Sequences for d2czje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2czje1 b.111.1.1 (E:2-123) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]}
apvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyia
pyekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglar
gk

SCOP Domain Coordinates for d2czje1:

Click to download the PDB-style file with coordinates for d2czje1.
(The format of our PDB-style files is described here.)

Timeline for d2czje1: