![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
![]() | Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins) contains irregular array of helices in the N-terminal extension automatically mapped to Pfam PF02211 |
![]() | Protein Iron-containing nitrile hydratase [50102] (1 species) |
![]() | Species Rhodococcus erythropolis [TaxId:1833] [50103] (28 PDB entries) also Rhodococcus sp. R312 |
![]() | Domain d2cyzb_: 2cyz B: [131031] Other proteins in same PDB: d2cyza_ automated match to d2ahjd_ complexed with fe, mg |
PDB Entry: 2cyz (more details), 1.55 Å
SCOPe Domain Sequences for d2cyzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cyzb_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]} mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty hvkfaaeelfgsdtdggsvvvdlfegylepa
Timeline for d2cyzb_: