PDB entry 2cyz

View 2cyz on RCSB PDB site
Description: photo-activation state of Fe-type NHase in anaerobic condition
Class: lyase
Keywords: CYSTEINE-SULFINIC ACID, CYSTEINE-SULFENIC ACID, POST-TRANSLATIONAL MODIFICATION, NITRILE, HYDRATION, NON-HEM IRON, photo-reactive, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2005-07-09, released 2006-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.149
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase subunit alpha
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13448
      • modified residue (111)
      • modified residue (113)
    Domains in SCOPe 2.07: d2cyza_
  • Chain 'B':
    Compound: Nitrile hydratase subunit beta
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cyzb_
  • Heterogens: FE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cyzA (A:)
    svtidhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelv
    arawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpil
    glpptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagteg
    wsqeqlqeivtkdcligvaipqvptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cyzA (A:)
    tenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdp
    efrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwy
    ksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlq
    eivtkdcligvaipqvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cyzB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cyzB (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepa