Lineage for d2cyza_ (2cyz A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. Protein automated matches [190256] (6 species)
    not a true protein
  7. Species Rhodococcus erythropolis [TaxId:1833] [187042] (24 PDB entries)
  8. Domain d2cyza_: 2cyz A: [131030]
    Other proteins in same PDB: d2cyzb_
    automated match to d2ahja_
    complexed with fe, mg

Details for d2cyza_

PDB Entry: 2cyz (more details), 1.55 Å

PDB Description: photo-activation state of Fe-type NHase in anaerobic condition
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2cyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cyza_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
tenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdp
efrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwy
ksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlq
eivtkdcligvaipqvp

SCOPe Domain Coordinates for d2cyza_ are not available.

Timeline for d2cyza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cyzb_