Lineage for d2cy2a1 (2cy2 A:1-174)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209433Protein Probable acetyltransferase TTHA1209 [118068] (1 species)
  7. 2209434Species Thermus thermophilus [TaxId:274] [118069] (2 PDB entries)
    Uniprot Q5SJ05
  8. 2209435Domain d2cy2a1: 2cy2 A:1-174 [131016]
    complexed with aco

Details for d2cy2a1

PDB Entry: 2cy2 (more details), 2 Å

PDB Description: Crystal structure of TTHA1209 in complex with acetyl coenzyme A
PDB Compounds: (A:) Probable acetyltransferase

SCOPe Domain Sequences for d2cy2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]}
vrirragledlpgvarvlvdtwratyrgvvpeafleglsyegqaerwaqrlktptwpgrl
fvaesesgevvgfaafgpdrasgfpgytaelwaiyvlptwqrkglgralfhegarllqae
gygrmlvwvlkenpkgrgfyehlggvllgereielggaklwevaygfdlgghkw

SCOPe Domain Coordinates for d2cy2a1:

Click to download the PDB-style file with coordinates for d2cy2a1.
(The format of our PDB-style files is described here.)

Timeline for d2cy2a1: