![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.7: TTHA0967-like [143187] (2 proteins) contains extra C-terminal helix |
![]() | Protein Hypothetical protein TTHA0967 [143188] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143189] (1 PDB entry) Uniprot Q5SJP1 1-138 |
![]() | Domain d2cwzc_: 2cwz C: [130963] automated match to d2cwza1 complexed with edo |
PDB Entry: 2cwz (more details), 1.85 Å
SCOPe Domain Sequences for d2cwzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwzc_ d.38.1.7 (C:) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk akvealfrrlkerweae
Timeline for d2cwzc_: