![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.7: TTHA0967-like [143187] (2 proteins) contains extra C-terminal helix |
![]() | Protein Hypothetical protein TTHA0967 [143188] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143189] (1 PDB entry) Uniprot Q5SJP1 1-138 |
![]() | Domain d2cwza1: 2cwz A:1-138 [130961] complexed with edo |
PDB Entry: 2cwz (more details), 1.85 Å
SCOPe Domain Sequences for d2cwza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk akvealfrrlkerweaer
Timeline for d2cwza1: