Lineage for d2cwzd_ (2cwz D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. Family d.38.1.7: TTHA0967-like [143187] (2 proteins)
    contains extra C-terminal helix
  6. Protein Hypothetical protein TTHA0967 [143188] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [143189] (1 PDB entry)
    Uniprot Q5SJP1 1-138
  8. Domain d2cwzd_: 2cwz D: [130964]
    automated match to d2cwza1
    complexed with edo

Details for d2cwzd_

PDB Entry: 2cwz (more details), 1.85 Å

PDB Description: Crystal structure of the Thermus thermophilus hypothetical protein TTHA0967, a thioesterase superfamily member
PDB Compounds: (D:) thioesterase family protein

SCOPe Domain Sequences for d2cwzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwzd_ d.38.1.7 (D:) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]}
mrpipegyeavfetvvtpemtvrfeelgpvhpvyatywmvkhmelagrkiilpfleegee
gigsyvearhlasalpgmrvrvvarhektegnrvyarveaynelgdligvgrteqvilpk
akvealfrrlkerweae

SCOPe Domain Coordinates for d2cwzd_ are not available.

Timeline for d2cwzd_:

Domains from other chains:
(mouse over for more information)
d2cwza1, d2cwzb_, d2cwzc_