Lineage for d2cw0o1 (2cw0 O:2-96)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284114Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1284115Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1284116Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 1284117Protein RNA polymerase omega subunit [63564] (3 species)
  7. 1284125Species Thermus thermophilus [TaxId:274] [74729] (4 PDB entries)
    Uniprot Q8RQE7; part of multichain biological unit
  8. 1284133Domain d2cw0o1: 2cw0 O:2-96 [130914]
    Other proteins in same PDB: d2cw0a1, d2cw0a2, d2cw0b1, d2cw0b2, d2cw0c1, d2cw0d1, d2cw0f1, d2cw0f2, d2cw0f3, d2cw0k1, d2cw0k2, d2cw0l1, d2cw0l2, d2cw0m1, d2cw0n1, d2cw0p1, d2cw0p2, d2cw0p3
    automatically matched to d1iw7e_
    complexed with mg, zn

Details for d2cw0o1

PDB Entry: 2cw0 (more details), 3.3 Å

PDB Description: crystal structure of thermus thermophilus rna polymerase holoenzyme at 3.3 angstroms resolution
PDB Compounds: (O:) RNA polymerase omega chain

SCOPe Domain Sequences for d2cw0o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cw0o1 a.143.1.1 (O:2-96) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d2cw0o1:

Click to download the PDB-style file with coordinates for d2cw0o1.
(The format of our PDB-style files is described here.)

Timeline for d2cw0o1: