| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) ![]() |
| Family a.4.13.1: Sigma3 domain [88660] (3 proteins) |
| Protein Sigma70 [88661] (1 species) |
| Species Thermus thermophilus [TaxId:274] [88662] (10 PDB entries) Uniprot Q9WX78 |
| Domain d2cw0p1: 2cw0 P:258-318 [130915] Other proteins in same PDB: d2cw0a1, d2cw0a2, d2cw0b1, d2cw0b2, d2cw0c1, d2cw0d1, d2cw0e1, d2cw0f2, d2cw0f3, d2cw0k1, d2cw0k2, d2cw0l1, d2cw0l2, d2cw0m1, d2cw0n1, d2cw0o1, d2cw0p2, d2cw0p3 automatically matched to d1iw7f1 complexed with mg, zn |
PDB Entry: 2cw0 (more details), 3.3 Å
SCOPe Domain Sequences for d2cw0p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cw0p1 a.4.13.1 (P:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e
Timeline for d2cw0p1: