![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H2B [47119] (5 species) |
![]() | Species Human (Homo sapiens), H2B.k [TaxId:9606] [140394] (1 PDB entry) |
![]() | Domain d2cv5d1: 2cv5 D:27-122 [130850] Other proteins in same PDB: d2cv5a1, d2cv5b1, d2cv5c1, d2cv5e1, d2cv5f1, d2cv5g1 complexed with cl, mn |
PDB Entry: 2cv5 (more details), 2.5 Å
SCOP Domain Sequences for d2cv5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cv5d1 a.22.1.1 (D:27-122) Histone H2B {Human (Homo sapiens), H2B.k [TaxId: 9606]} krsrkesysvyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrsti tsreiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d2cv5d1: