Lineage for d2cv5d1 (2cv5 D:27-122)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637506Protein Histone H2B [47119] (5 species)
  7. 637569Species Human (Homo sapiens), H2B.k [TaxId:9606] [140394] (1 PDB entry)
  8. 637570Domain d2cv5d1: 2cv5 D:27-122 [130850]
    Other proteins in same PDB: d2cv5a1, d2cv5b1, d2cv5c1, d2cv5e1, d2cv5f1, d2cv5g1
    complexed with cl, mn

Details for d2cv5d1

PDB Entry: 2cv5 (more details), 2.5 Å

PDB Description: Crystal structure of human nucleosome core particle
PDB Compounds: (D:) Histone H2B K

SCOP Domain Sequences for d2cv5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv5d1 a.22.1.1 (D:27-122) Histone H2B {Human (Homo sapiens), H2B.k [TaxId: 9606]}
krsrkesysvyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrsti
tsreiqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d2cv5d1:

Click to download the PDB-style file with coordinates for d2cv5d1.
(The format of our PDB-style files is described here.)

Timeline for d2cv5d1: