![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (4 species) |
![]() | Species Mouse(Mus musculus), H3.1 [TaxId:10090] [140395] (2 PDB entries) |
![]() | Domain d2cv5a1: 2cv5 A:38-134 [130847] Other proteins in same PDB: d2cv5b1, d2cv5c1, d2cv5d1, d2cv5f1, d2cv5g1, d2cv5h1 automatically matched to 1U35 A:438-535 complexed with cl, mn |
PDB Entry: 2cv5 (more details), 2.5 Å
SCOP Domain Sequences for d2cv5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cv5a1 a.22.1.1 (A:38-134) Histone H3 {Mouse(Mus musculus), H3.1 [TaxId: 10090]} phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace aylvglfedtnlcaihakrvtimpkdiqlarrirger
Timeline for d2cv5a1: