Lineage for d2cv5a1 (2cv5 A:38-134)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637576Protein Histone H3 [47122] (4 species)
  7. 637640Species Mouse(Mus musculus), H3.1 [TaxId:10090] [140395] (2 PDB entries)
  8. 637641Domain d2cv5a1: 2cv5 A:38-134 [130847]
    Other proteins in same PDB: d2cv5b1, d2cv5c1, d2cv5d1, d2cv5f1, d2cv5g1, d2cv5h1
    automatically matched to 1U35 A:438-535
    complexed with cl, mn

Details for d2cv5a1

PDB Entry: 2cv5 (more details), 2.5 Å

PDB Description: Crystal structure of human nucleosome core particle
PDB Compounds: (A:) Histone H3.1

SCOP Domain Sequences for d2cv5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv5a1 a.22.1.1 (A:38-134) Histone H3 {Mouse(Mus musculus), H3.1 [TaxId: 10090]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
aylvglfedtnlcaihakrvtimpkdiqlarrirger

SCOP Domain Coordinates for d2cv5a1:

Click to download the PDB-style file with coordinates for d2cv5a1.
(The format of our PDB-style files is described here.)

Timeline for d2cv5a1: