Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Peroxiredoxin [117601] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [117602] (2 PDB entries) Uniprot Q9Y9L0 # APE2278 |
Domain d2cv4a1: 2cv4 A:24-173 [130837] Other proteins in same PDB: d2cv4b_, d2cv4c_, d2cv4d_, d2cv4e_, d2cv4f_, d2cv4g_, d2cv4h_, d2cv4i_, d2cv4j_ complexed with ipa, mes |
PDB Entry: 2cv4 (more details), 2.3 Å
SCOPe Domain Sequences for d2cv4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cv4a1 c.47.1.10 (A:24-173) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} iklpdhyvsqgkwfvlfshpadftpvcttefvsfarryedfqrlgvdliglsvdsvfshi kwkewierhigvripfpiiadpqgtvarrlgllhaesathtvrgvfivdargvirtmlyy pmelgrlvdeilrivkalklgdslkravpa
Timeline for d2cv4a1: