Lineage for d2ctza1 (2ctz A:1-421)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131620Protein O-acetyl-L-homoserine sulfhydrylase [142665] (1 species)
  7. 2131621Species Thermus thermophilus [TaxId:274] [142666] (1 PDB entry)
    Uniprot Q93I77 1-421
  8. 2131622Domain d2ctza1: 2ctz A:1-421 [130800]
    Other proteins in same PDB: d2ctzb_
    complexed with plp

Details for d2ctza1

PDB Entry: 2ctz (more details), 2.6 Å

PDB Description: Crystal structure of o-acetyl homoserine sulfhydrylase from Thermus thermophilus HB8
PDB Compounds: (A:) O-acetyl-L-homoserine sulfhydrylase

SCOPe Domain Sequences for d2ctza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]}
mrfetlqlhagyepepttlsrqvpiypttsyvfkspehaanlfalkefgniysrimnptv
dvlekrlaaleggkaalatasghaaqflalttlaqagdnivstpnlyggtfnqfkvtlkr
lgievrftsreerpeeflaltdektrawwvesignpalnipdlealaqaarekgvalivd
ntfgmggyllrplawgaalvthsltkwvgghgaviagaivdggnfpweggryplltepqp
gyhglrlteafgelafivkarvdglrdqgqalgpfeawvvllgmetlslraerhventlh
lahwlleqpqvawvnypglphhphhdraqkyfkgkpgavltfglkggyeaakrfisrlkl
ishlanvgdtrtlaihpastthsqlspeeqaqagvspemvrlsvglehvedlkaelkeal
a

SCOPe Domain Coordinates for d2ctza1:

Click to download the PDB-style file with coordinates for d2ctza1.
(The format of our PDB-style files is described here.)

Timeline for d2ctza1: