Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein O-acetyl-L-homoserine sulfhydrylase [142665] (1 species) |
Species Thermus thermophilus [TaxId:274] [142666] (1 PDB entry) Uniprot Q93I77 1-421 |
Domain d2ctza1: 2ctz A:1-421 [130800] Other proteins in same PDB: d2ctzb_ complexed with plp |
PDB Entry: 2ctz (more details), 2.6 Å
SCOPe Domain Sequences for d2ctza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} mrfetlqlhagyepepttlsrqvpiypttsyvfkspehaanlfalkefgniysrimnptv dvlekrlaaleggkaalatasghaaqflalttlaqagdnivstpnlyggtfnqfkvtlkr lgievrftsreerpeeflaltdektrawwvesignpalnipdlealaqaarekgvalivd ntfgmggyllrplawgaalvthsltkwvgghgaviagaivdggnfpweggryplltepqp gyhglrlteafgelafivkarvdglrdqgqalgpfeawvvllgmetlslraerhventlh lahwlleqpqvawvnypglphhphhdraqkyfkgkpgavltfglkggyeaakrfisrlkl ishlanvgdtrtlaihpastthsqlspeeqaqagvspemvrlsvglehvedlkaelkeal a
Timeline for d2ctza1: