PDB entry 2ctz

View 2ctz on RCSB PDB site
Description: Crystal structure of o-acetyl homoserine sulfhydrylase from Thermus thermophilus HB8
Class: transferase
Keywords: Crystal, o-acetyl homoserine sulfhydrase, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2005-05-24, released 2005-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.189
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-acetyl-L-homoserine sulfhydrylase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ctza1
  • Chain 'B':
    Compound: O-acetyl-L-homoserine sulfhydrylase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ctzb_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ctzA (A:)
    mrfetlqlhagyepepttlsrqvpiypttsyvfkspehaanlfalkefgniysrimnptv
    dvlekrlaaleggkaalatasghaaqflalttlaqagdnivstpnlyggtfnqfkvtlkr
    lgievrftsreerpeeflaltdektrawwvesignpalnipdlealaqaarekgvalivd
    ntfgmggyllrplawgaalvthsltkwvgghgaviagaivdggnfpweggryplltepqp
    gyhglrlteafgelafivkarvdglrdqgqalgpfeawvvllgmetlslraerhventlh
    lahwlleqpqvawvnypglphhphhdraqkyfkgkpgavltfglkggyeaakrfisrlkl
    ishlanvgdtrtlaihpastthsqlspeeqaqagvspemvrlsvglehvedlkaelkeal
    a
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ctzB (B:)
    mrfetlqlhagyepepttlsrqvpiypttsyvfkspehaanlfalkefgniysrimnptv
    dvlekrlaaleggkaalatasghaaqflalttlaqagdnivstpnlyggtfnqfkvtlkr
    lgievrftsreerpeeflaltdektrawwvesignpalnipdlealaqaarekgvalivd
    ntfgmggyllrplawgaalvthsltkwvgghgaviagaivdggnfpweggryplltepqp
    gyhglrlteafgelafivkarvdglrdqgqalgpfeawvvllgmetlslraerhventlh
    lahwlleqpqvawvnypglphhphhdraqkyfkgkpgavltfglkggyeaakrfisrlkl
    ishlanvgdtrtlaihpastthsqlspeeqaqagvspemvrlsvglehvedlkaelkeal
    a