Lineage for d2ctzb_ (2ctz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895682Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2895951Protein automated matches [190399] (10 species)
    not a true protein
  7. 2896004Species Thermus thermophilus [TaxId:274] [187566] (1 PDB entry)
  8. 2896005Domain d2ctzb_: 2ctz B: [130801]
    Other proteins in same PDB: d2ctza1
    automated match to d2ctza1
    complexed with plp

Details for d2ctzb_

PDB Entry: 2ctz (more details), 2.6 Å

PDB Description: Crystal structure of o-acetyl homoserine sulfhydrylase from Thermus thermophilus HB8
PDB Compounds: (B:) O-acetyl-L-homoserine sulfhydrylase

SCOPe Domain Sequences for d2ctzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ctzb_ c.67.1.3 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
mrfetlqlhagyepepttlsrqvpiypttsyvfkspehaanlfalkefgniysrimnptv
dvlekrlaaleggkaalatasghaaqflalttlaqagdnivstpnlyggtfnqfkvtlkr
lgievrftsreerpeeflaltdektrawwvesignpalnipdlealaqaarekgvalivd
ntfgmggyllrplawgaalvthsltkwvgghgaviagaivdggnfpweggryplltepqp
gyhglrlteafgelafivkarvdglrdqgqalgpfeawvvllgmetlslraerhventlh
lahwlleqpqvawvnypglphhphhdraqkyfkgkpgavltfglkggyeaakrfisrlkl
ishlanvgdtrtlaihpastthsqlspeeqaqagvspemvrlsvglehvedlkaelkeal
a

SCOPe Domain Coordinates for d2ctzb_:

Click to download the PDB-style file with coordinates for d2ctzb_.
(The format of our PDB-style files is described here.)

Timeline for d2ctzb_: