Lineage for d2ctda2 (2ctd A:61-90)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462985Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1462986Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1462987Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1463191Protein Zinc finger protein 512, ZNF512 [144135] (1 species)
  7. 1463192Species Human (Homo sapiens) [TaxId:9606] [144136] (1 PDB entry)
    Uniprot Q96ME7 142-194! Uniprot Q96ME7 195-224
  8. 1463194Domain d2ctda2: 2ctd A:61-90 [130793]
    atypical ZnF "0" with N-terminal helical extension
    complexed with zn

Details for d2ctda2

PDB Entry: 2ctd (more details)

PDB Description: solution structure of two zf-c2h2 domains from human zinc finger protein 512
PDB Compounds: (A:) Zinc finger protein 512

SCOPe Domain Sequences for d2ctda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]}
emftchhcgkqlrslagmkyhvmanhnslp

SCOPe Domain Coordinates for d2ctda2:

Click to download the PDB-style file with coordinates for d2ctda2.
(The format of our PDB-style files is described here.)

Timeline for d2ctda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ctda1