PDB entry 2ctd

View 2ctd on RCSB PDB site
Description: Solution structure of two zf-C2H2 domains from human Zinc finger protein 512
Class: metal binding protein
Keywords: Zinc binding, two zf-C2H2 domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-05-24, released 2005-11-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 512
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF512
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96ME7 (7-89)
      • cloning artifact (0-6)
      • cloning artifact (90-95)
    Domains in SCOPe 2.03: d2ctda1, d2ctda2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ctdA (A:)
    gssgssgrirkeppvyaagsleeqwyleivdkgsvscptcqavgrktieglkkhmenckq
    emftchhcgkqlrslagmkyhvmanhnslpsgpssg