| Class g: Small proteins [56992] (100 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
| Protein Zinc finger protein 512, ZNF512 [144135] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [144136] (1 PDB entry) Uniprot Q96ME7 142-194! Uniprot Q96ME7 195-224 |
| Domain d2ctda2: 2ctd A:61-90 [130793] Other proteins in same PDB: d2ctda3, d2ctda4 atypical ZnF "0" with N-terminal helical extension complexed with zn |
PDB Entry: 2ctd (more details)
SCOPe Domain Sequences for d2ctda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]}
emftchhcgkqlrslagmkyhvmanhnslp
Timeline for d2ctda2: